DPCfam | MC419808
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 140 ± 36 aa |
| Residues in low-complexity regions (%) | 6.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.63 |
| Average transmembrane regions | 2.86 |
| Dominant Pfam architecture(s) | PF10190 |
| Sequences matching dominant architecture (%) | 75.24 |
| Average overlap percent | 70.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M2LWJ5 | 613-738 | 126 | PLSYTPPQFPALYWPFPVYGTQTQYLYDARSMWLFTLYWTLICVVGIHIIAASYAVAMQWKNWKIVWVVPIIYVVVGGIEAVIAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5AEB7-F1 | 11-149 | 99.28 | 87.73 | View in AlphaFoldDB ↗ |