DPCfam | MC419680
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Residues in low-complexity regions (%) | 4.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.28 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12623 |
| Sequences matching dominant architecture (%) | 97.87 |
| Average overlap percent | 45.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J6SWM0 | 1-91 | 91 | MFLSVATTHRPATDLGFLLHKNPHRTQDLDLGFGRAVMLYPEATEARCEFVLTLDIDPIALVRGSAGGEGLLDHYVNDRPYAASS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EVX7-F1 | 13-118 | 100.00 | 83.48 | View in AlphaFoldDB ↗ |