DPCfam | MC419578
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 143 ± 23 aa |
| Residues in low-complexity regions (%) | 12.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 57.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00084A8C8D | 2142-2242 | 101 | ELLRDCHVSDFDLEASVQKVLRGHQAGLSPQKGPMLSKGPTKFRGSSIPTRAAAGRGIRPYGFATRGLNSRSDPFRCRPPNTSRP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IAI1-F1 | 1540-1681 | 94.48 | 43.83 | View in AlphaFoldDB ↗ |