DPCfam | MC419558
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 173 ± 26 aa |
| Residues in low-complexity regions (%) | 11.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.54 |
| Average transmembrane regions | 1.71 |
| Dominant Pfam architecture(s) | PF06805 |
| Sequences matching dominant architecture (%) | 48.59 |
| Average overlap percent | 40.01 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G0MFR5 | 3-215 | 213 | LKQIVLHGELGVLFGEHWQLDVLTPAEAVFAINVNRPGFTRHLCASEAEGIGYRILLDDEPIDPAALAHPFGRETFHIVPILSGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZQF8-F1 | 19-213 | 100.00 | 69.19 | View in AlphaFoldDB ↗ |