DPCfam | MC419533
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 207 ± 32 aa |
| Residues in low-complexity regions (%) | 5.27 |
| Residues in coiled-coil regions (%) | 0.13 |
| Predicted disordered residues (%) | 3.07 |
| Average transmembrane regions | 5.05 |
| Dominant Pfam architecture(s) | PF07264 |
| Sequences matching dominant architecture (%) | 91.96 |
| Average overlap percent | 81.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B8AU03 | 41-257 | 217 | RIAQCFLLNGFIFLGSLLTLKSVVIPILSWILPGDCSQLQEQHLCDHTVAVATYSFLRSVLIQIFYVLWFYPLYIFSFVLSTLWY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MJW7-F1 | 43-285 | 98.11 | 81.00 | View in AlphaFoldDB ↗ |