DPCfam | MC41953
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Residues in low-complexity regions (%) | 3.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06588 |
| Sequences matching dominant architecture (%) | 96.72 |
| Average overlap percent | 57.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A137NXB1 | 108-205 | 98 | HTSKLKYSIHSWSSHSSCFYPENILVDNPNDQSSRWSTGNNNLTQFIMLELEQVSVVQTITFGKYNKVHVCNLKEFKVYGGLTPN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5RB35-F1 | 16-116 | 99.04 | 93.37 | View in AlphaFoldDB ↗ |