DPCfam | MC419471
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Residues in low-complexity regions (%) | 6.67 |
| Residues in coiled-coil regions (%) | 8.55 |
| Predicted disordered residues (%) | 2.15 |
| Average transmembrane regions | 1.82 |
| Dominant Pfam architecture(s) | PF12056 |
| Sequences matching dominant architecture (%) | 93.1 |
| Average overlap percent | 41.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A124SET6 | 196-280 | 85 | RTSVFFLVCVLFKLTCSLQILRLEDFAKVFEKQADVGSILLEHLNLCSVTLVSGLFICLRSAAKITHKAQSVTSLAAKWHTCATV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6YTJ0-F1 | 198-331 | 99.26 | 83.88 | View in AlphaFoldDB ↗ |