DPCfam | MC419330
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12843 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 92.47 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B4EZR0 | 3-71 | 69 | EKQHLIDIANTQMPFGKYKGRMLVDLPEEYLLWFAKKGTFPEGKLGQLMEMTLAIKIDGLEGLLKPLKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HY14-F1 | 6-69 | 95.52 | 96.13 | View in AlphaFoldDB ↗ |