DPCfam | MC418919
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Residues in low-complexity regions (%) | 1.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.65 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF08498 |
| Sequences matching dominant architecture (%) | 99.03 |
| Average overlap percent | 67.99 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L1JFZ3 | 241-345 | 105 | KNAGFEVLHHEDLADRPDAIPWYYPLAGSFKHMTSPWDFFTIARMTWWGRGIAHRFVGALETVGLAPKGTQKTADSLAVAGDCLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9LM02-F1 | 245-336 | 100.00 | 93.26 | View in AlphaFoldDB ↗ |