DPCfam | MC418806
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 207 ± 25 aa |
| Residues in low-complexity regions (%) | 8.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.97 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF00248 |
| Sequences matching dominant architecture (%) | 0.88 |
| Average overlap percent | 1.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L6V971 | 114-372 | 259 | ISRLDATSPLLPQNLANFITAASLAARVSLRSSAFFIELILESLRYSTTTSLGITRRALISAVGSARAIHYNTSNHSHTTDSNSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W5J1-F1 | 37-242 | 99.06 | 77.45 | View in AlphaFoldDB ↗ |