DPCfam | MC418740
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 8.92 |
| Predicted disordered residues (%) | 8.98 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12309 |
| Sequences matching dominant architecture (%) | 99.34 |
| Average overlap percent | 38.86 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J1I787 | 334-438 | 105 | SLYEREVVDDFVLTFEDAKEVFLAAQSYLNKAKEYYSLENEASQHARIVQDYAHIFKHLAFFEDEPGVQSKLHKRRADQLEEVLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0IIZ5-F1 | 373-483 | 98.23 | 96.88 | View in AlphaFoldDB ↗ |