DPCfam | MC418656
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 211 ± 33 aa |
| Residues in low-complexity regions (%) | 5.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.97 |
| Average transmembrane regions | 0.92 |
| Dominant Pfam architecture(s) | PF11875 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 66.86 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F8BUA2 | 662-855 | 194 | VHLSLYWARLSHAISLPVLVAPRTMISDKMVAWGAVVPFVTVALGQFGRRWLNRSRVAKKMARNQEAVRAYVDQKRVDAEEVEYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5U458-F1 | 343-550 | 99.06 | 87.88 | View in AlphaFoldDB ↗ |