DPCfam | MC418578
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Residues in low-complexity regions (%) | 0.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00373 |
| Sequences matching dominant architecture (%) | 3.61 |
| Average overlap percent | 91.84 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7TBZ6 | 1183-1265 | 83 | DPVSTNLIYQQVIRGIKYGEYRCDKDEELAAICAQQYYIDEGTMDVNKLENNLTSYLPDFEMAGKDMALEKWTQTIMHQYRKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q29P71-F1 | 1352-1435 | 98.82 | 86.45 | View in AlphaFoldDB ↗ |