DPCfam | MC418551
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 5991 |
|---|---|
| Mean domain length (aa) | 153 ± 44 aa |
| Residues in low-complexity regions (%) | 2.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.69 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00717 |
| Sequences matching dominant architecture (%) | 62.36 |
| Average overlap percent | 53.14 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7HUQ8 | 17-171 | 155 | ILLALAIAFVIKIFIMDATKVEGNSMLNTLHSGDMLFVDKVSKHFKGYNRADIVIINAPDQEDTLYIKRIVGMPGDNIEVKDGNV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q89AM6-F1 | 71-287 | 96.43 | 82.89 | View in AlphaFoldDB ↗ |