DPCfam | MC418548
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 187 ± 33 aa |
| Residues in low-complexity regions (%) | 7.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 64.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08688 |
| Sequences matching dominant architecture (%) | 68.22 |
| Average overlap percent | 78.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A093SL25 | 572-753 | 182 | AKLQKSRSTATLVGSSEAEECNETWKPDSAGNVTTSPDTNFTSTYKDHLKEAQARVLRATSFKRRDLEPSPAEYLPRSPERKTGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IS11-F1 | 808-1019 | 100.00 | 52.60 | View in AlphaFoldDB ↗ |