DPCfam | MC41850
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 317 ± 85 aa |
| Residues in low-complexity regions (%) | 27.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 75.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W4XD94 | 491-878 | 387 | LLDELQTFSKPHPPLSTQTSTQSVINSDTSSDPPAIPVKGIPATNSSVHFTHPPTMSEIGRKGSMDSATFLPTQNLTISTIPGNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7KW14-F1 | 798-1234 | 100.00 | 40.38 | View in AlphaFoldDB ↗ |