DPCfam | MC418391
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Residues in low-complexity regions (%) | 20.74 |
| Residues in coiled-coil regions (%) | 2.72 |
| Predicted disordered residues (%) | 22.95 |
| Average transmembrane regions | 0.84 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A135ZAJ1 | 1-105 | 105 | MPWWIWLILAIFFVSMFLIGSVYAFIKLNKGLVVVSESADKISDIYDRFDTLDNKTVDDKPLFTQPIAVAARRYEEAHKRVILRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044TJF8-F1 | 182-280 | 73.33 | 63.54 | View in AlphaFoldDB ↗ |