DPCfam | MC41821
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Residues in low-complexity regions (%) | 1.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00293 |
| Sequences matching dominant architecture (%) | 78.95 |
| Average overlap percent | 13.24 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5WAT2 | 131-196 | 66 | EQFRLQEEEVAGMVRVPFSAFYQLCFGTVKAIESDGFVEEGKIRRPYCEQVTLNDLVPHQQPFLQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q97LV8-F1 | 131-202 | 96.00 | 95.49 | View in AlphaFoldDB ↗ |