DPCfam | MC417915
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Residues in low-complexity regions (%) | 0.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10118 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 24.63 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M5NUE8 | 124-183 | 60 | QQLAMTLCLEHFTAIMAHAVLSDDAVLAGAHPTMRQMWRWHALEETEHKAVAFDLYRHVF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I5A9-F1 | 124-181 | 95.08 | 97.08 | View in AlphaFoldDB ↗ |