DPCfam | MC417878
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Residues in low-complexity regions (%) | 0.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.0 |
| Average transmembrane regions | 0.33 |
| Dominant Pfam architecture(s) | PF00561 |
| Sequences matching dominant architecture (%) | 94.55 |
| Average overlap percent | 39.37 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A4BS11 | 89-186 | 98 | LDDIEVLRKYLGIERWVVFGGSWGATLALCYAQRYPEHVQALLVRGTLLGRARDLEWFFGAYGVASILPEAYQRFLAPLPPAARD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HUA3-F1 | 89-185 | 98.02 | 98.55 | View in AlphaFoldDB ↗ |