DPCfam | MC417543
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 217 ± 24 aa |
| Residues in low-complexity regions (%) | 5.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S8EMC3 | 5-222 | 218 | IPEGGTKSRVETQVRLTVDLAHASASSGEPLKYDRVGTWKWLRLPRGTSTKKRTRKEGKIDASPEDTLYLTAEVTCATAPHTRAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VPI0-F1 | 291-518 | 98.90 | 82.13 | View in AlphaFoldDB ↗ |