DPCfam | MC417258
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2421 |
|---|---|
| Mean domain length (aa) | 184 ± 19 aa |
| Residues in low-complexity regions (%) | 1.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06452 |
| Sequences matching dominant architecture (%) | 61.44 |
| Average overlap percent | 85.65 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G3R8L0 | 40-230 | 191 | PALAVDQPVGEPPSHAPRTLARLCWDDRCLHVVFRVEDRYVRALAQKYQDPVCRDSCVEFFFTPGTDLRAGYFNIEMNCGGTVLF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P38535-F1 | 543-676 | 85.91 | 93.05 | View in AlphaFoldDB ↗ |