DPCfam | MC417215
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Residues in low-complexity regions (%) | 2.57 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 16.83 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03883 |
| Sequences matching dominant architecture (%) | 1.17 |
| Average overlap percent | 56.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E4FAF9 | 7-138 | 132 | SILLLQSCSDSKQEVAKRLPALNLYSGYFYKIIKKAIRENDLRADMDLRILSAEHGLLHPDTEILHYDRKMDTERAKQLQDDVVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31547-F1 | 3-138 | 98.47 | 96.58 | View in AlphaFoldDB ↗ |