DPCfam | MC416625
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Residues in low-complexity regions (%) | 1.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.79 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03407 |
| Sequences matching dominant architecture (%) | 89.92 |
| Average overlap percent | 4.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7J0K4 | 66-132 | 67 | RGDVDPVNSEDARLERVLRAAAMANGTVILTTLNSAWAEPGSVVDVFLESFRIGDETRWLLDHLVMV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1P8B5X7-F1 | 80-137 | 93.55 | 96.93 | View in AlphaFoldDB ↗ |