DPCfam | MC416524
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Residues in low-complexity regions (%) | 17.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.64 |
| Average transmembrane regions | 1.67 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F4JUB5 | 60-128 | 69 | WVQKDGYEYPLVLIVVATVLALTGPGRYSVDQALGLAPWAAWWVAVTLLGGVGSGLAVRVLLHRPEPVT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I6YAV3-F1 | 216-278 | 98.44 | 81.64 | View in AlphaFoldDB ↗ |