DPCfam | MC415550
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 105 ± 19 aa |
| Residues in low-complexity regions (%) | 4.88 |
| Residues in coiled-coil regions (%) | 0.42 |
| Predicted disordered residues (%) | 29.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08165 |
| Sequences matching dominant architecture (%) | 2.78 |
| Average overlap percent | 6.38 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3HQG6 | 87-187 | 101 | GNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLRIADRLEASLEQIHLALKAQCSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5SPC5-F1 | 621-747 | 99.10 | 71.60 | View in AlphaFoldDB ↗ |