DPCfam | MC414978
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 471 |
|---|---|
| Mean domain length (aa) | 129 ± 14 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16461 |
| Sequences matching dominant architecture (%) | 41.21 |
| Average overlap percent | 88.0 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X4N2K7 | 6-149 | 144 | AAGCKLSISDDVSTSTTKTEFEAETFVKVGEIADIGEFGSEFSAINFSNLEDRLQRKFKGVEDPGTLTLNLGLDPADTGQGQLQT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G3XD38-F1 | 18-156 | 91.41 | 93.06 | View in AlphaFoldDB ↗ |