DPCfam | MC414926
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 180 ± 23 aa |
| Residues in low-complexity regions (%) | 2.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.89 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01213 |
| Sequences matching dominant architecture (%) | 49.08 |
| Average overlap percent | 18.03 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A077Z7C2 | 35-240 | 206 | SGGSEPTTEREPAAYSKVVEDFDETVMPSVQKFNKTCSSIGDVVGQLGSLVLLTFQQQRDFICRAAASTKPDQQAMQKLLEPTSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6YBS2-F1 | 40-208 | 96.00 | 94.11 | View in AlphaFoldDB ↗ |