DPCfam | MC41474
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Residues in low-complexity regions (%) | 1.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.87 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007AD3B87 | 87-145 | 59 | QSSVVFDISSLILYGTQALPVRMKILLDRLFSVLTHTQVLNIIHTLGWTLRDYVRGYML... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QMP5-F1 | 52-109 | 96.67 | 85.40 | View in AlphaFoldDB ↗ |