DPCfam | MC41439
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 181 ± 28 aa |
| Residues in low-complexity regions (%) | 2.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13245 |
| Sequences matching dominant architecture (%) | 18.12 |
| Average overlap percent | 33.19 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M8B4G1 | 783-995 | 213 | AHKEHDLVDTSYAMENSKVNESFLLMKFYSLSSGMAKHLLTATDGSEINIPFELSDEEKVIIQFPLTSFILGRSGTGKTTVLTMK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0WE98-F1 | 801-987 | 97.25 | 62.54 | View in AlphaFoldDB ↗ |