DPCfam | MC41426
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 681 |
|---|---|
| Mean domain length (aa) | 198 ± 22 aa |
| Residues in low-complexity regions (%) | 12.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.39 |
| Average transmembrane regions | 4.32 |
| Dominant Pfam architecture(s) | PF16927 |
| Sequences matching dominant architecture (%) | 19.65 |
| Average overlap percent | 24.68 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1EVB8 | 143-343 | 201 | FMGFMGAGFVKLIKKYRSSVGLVKKQLWFFLTGLIISFSLLTATNFVAVVVFRSIQLTYLGPPFTLILFVFVMYAIVRHRFLDIT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7MRY4-F1 | 166-339 | 89.85 | 87.25 | View in AlphaFoldDB ↗ |