DPCfam | MC41394
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 92 ± 14 aa |
| Residues in low-complexity regions (%) | 12.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 59.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16450 |
| Sequences matching dominant architecture (%) | 16.0 |
| Average overlap percent | 10.68 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F8AEP1 | 37-144 | 108 | RLGRKKRKAAGPSTASKLPDIFPTSRCKLRYLRMQRVHDHLLLEEEYVENMERLRKTKAQAAQDSVSRSEFDIMDRNADERGRVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P48601-F1 | 15-121 | 100.00 | 70.40 | View in AlphaFoldDB ↗ |