DPCfam | MC413730
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1451 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.66 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF07261 |
| Sequences matching dominant architecture (%) | 91.13 |
| Average overlap percent | 79.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A5VPV1 | 173-262 | 90 | SPTKATVYDLYQENFGVISPFIVESIDYDIKEHGEELVIEAMKRARLNQANYKYAQGILESWSKQGVKTMEDVKASDVEHNQKKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132YZY5-F1 | 125-206 | 94.12 | 94.44 | View in AlphaFoldDB ↗ |