DPCfam | MC41373
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 1025 ± 194 aa |
| Residues in low-complexity regions (%) | 1.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.38 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF14646 |
| Sequences matching dominant architecture (%) | 10.0 |
| Average overlap percent | 15.12 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R4IEX1 | 1415-2577 | 1163 | VLVPSELKFHSSCCVGIASHTSLNIFNPSKHWQQVSISTTSISIDGEKVESLPFQWLIVKNKAIIGPKCSEEHKVLFIAPKAGLY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8TEP8-F1 | 1430-2532 | 100.00 | 74.19 | View in AlphaFoldDB ↗ |