DPCfam | MC413580
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Residues in low-complexity regions (%) | 2.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.3 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00618 |
| Sequences matching dominant architecture (%) | 80.21 |
| Average overlap percent | 31.01 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7TQP0 | 551-704 | 154 | NSEKKDTNYNGLDFRLIIDTKSGPPITIILLASTLQEKAAWCSDISQCIENLHYTDLLHSSMSDTSSVTMPQSVRSDPKLFRDDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KLA8-F1 | 417-561 | 98.64 | 77.62 | View in AlphaFoldDB ↗ |