DPCfam | MC413208
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 436 ± 78 aa |
| Residues in low-complexity regions (%) | 4.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08005 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.1 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D8XWJ9 | 1319-1712 | 394 | RRRSAVCAWDMSEGATDAICIRVDGGRIALRGVGVYLHAEQIKKTWHCEIYMLRDSDQFSLLTKTSCELNNGGAADTGIILLPDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q965Y9-F1 | 1490-1896 | 99.10 | 73.28 | View in AlphaFoldDB ↗ |