DPCfam | MC413168
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 1788 ± 305 aa |
| Residues in low-complexity regions (%) | 5.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.78 |
| Average transmembrane regions | 1.35 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V2X7F4 | 300-2412 | 2113 | LPNEGLVLSTLLYPFFVPDSPVVEEERVLALRAFDVILRTWNPFDEIVAAERAIFCTKVVLLLCPDRNASSSSPPQTPLRMHALN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7GHE1-F1 | 173-657 | 21.85 | 69.88 | View in AlphaFoldDB ↗ |