DPCfam | MC412976
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 57 ± 7 aa |
| Residues in low-complexity regions (%) | 10.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.42 |
| Average transmembrane regions | 1.22 |
| Dominant Pfam architecture(s) | PF04923 |
| Sequences matching dominant architecture (%) | 98.75 |
| Average overlap percent | 51.39 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W4WC67 | 129-192 | 64 | LFLIIVSLILQVGVGVALIFKGRLDLKGKSKHQSAKTINNYVVAGIFLVTIINVFIASFTITNV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O70131-F1 | 87-143 | 98.28 | 70.23 | View in AlphaFoldDB ↗ |