DPCfam | MC412913
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 255 ± 36 aa |
| Residues in low-complexity regions (%) | 0.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B0KQ20 | 33-296 | 264 | AYQEGNLVAARLSERYHYAPPDCGEDSKPAFLCSGVIFRATHYSPAYDAWNPSPPSVVSGGVSFSYLRKDAKFNTMLPGQHNGYI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2J0-F1 | 31-287 | 99.20 | 97.13 | View in AlphaFoldDB ↗ |