DPCfam | MC412849
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 369 ± 62 aa |
| Residues in low-complexity regions (%) | 1.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.74 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F3ZC83 | 156-597 | 442 | DSFNLQIYTKLLTALGKAFPRKEAQIVRSSVYATLNGRSWRRKAAVYLARICSGLGHRARQSIVLRDSLFSKLFQLRLLIKTMGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54G73-F1 | 74-157 | 23.18 | 88.70 | View in AlphaFoldDB ↗ |