DPCfam | MC412653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 56 ± 11 aa |
| Residues in low-complexity regions (%) | 3.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 52.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00612 |
| Sequences matching dominant architecture (%) | 2.78 |
| Average overlap percent | 33.33 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A7Y6P3 | 118-194 | 77 | LSIRKHRSLHIESNGFSAGVGEHMKKEDMYDEIIRLKKSLHSQKSDNQQMKVKLRRLEEDNHKRERQIEELLDPTKG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6IPM2-F1 | 128-189 | 98.41 | 85.05 | View in AlphaFoldDB ↗ |