DPCfam | MC412172
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 416 ± 68 aa |
| Residues in low-complexity regions (%) | 12.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 59.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12931 |
| Sequences matching dominant architecture (%) | 91.84 |
| Average overlap percent | 12.25 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8NZN7 | 892-1367 | 476 | EAIQRTELFEYSKTLGNSQFLLLPFQPYKLIYAYMLAEVGKMADSLKYCQAILKSLRTGRTTEVETWKQLVSSLEERLRIHQQGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1J9V8-F1 | 956-1375 | 99.76 | 42.80 | View in AlphaFoldDB ↗ |