DPCfam | MC412081
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 187 ± 26 aa |
| Residues in low-complexity regions (%) | 3.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.21 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF05053 |
| Sequences matching dominant architecture (%) | 90.57 |
| Average overlap percent | 48.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009512985 | 310-527 | 218 | YDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O00255-F1 | 273-462 | 99.44 | 92.65 | View in AlphaFoldDB ↗ |