DPCfam | MC412045
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Residues in low-complexity regions (%) | 0.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.36 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S7HSK1 | 7-154 | 148 | GETAESQQQKKDKLKMMSLQKEANPEEMKELLRTTFYSQRKDINQGKSIQDVLEAWPVLFHDIGMAVHYKELTGLGLKETFMRNI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I3IT02-F1 | 301-418 | 98.29 | 94.67 | View in AlphaFoldDB ↗ |