DPCfam | MC411953
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 941 |
|---|---|
| Mean domain length (aa) | 175 ± 17 aa |
| Residues in low-complexity regions (%) | 1.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04313 |
| Sequences matching dominant architecture (%) | 99.48 |
| Average overlap percent | 88.41 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C6R862 | 43-218 | 176 | LENNLIEILTSQGYRRVSCRDEKSLLANLRGHLSRLNDVEFTDAEWNRLLQEFITPHDDDVLAKTRRIQHERAVYTFTFDDGTRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O05052-F1 | 10-194 | 98.79 | 91.42 | View in AlphaFoldDB ↗ |