DPCfam | MC411879
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 147 ± 16 aa |
| Residues in low-complexity regions (%) | 2.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A140GIW5 | 876-1022 | 147 | QIYKDVLQHWYYTPFNRLLLKFDVDSFIRRQPTAHFLTKKEENLLHLKRFLLADYYNTLRWYSYMQHYEAMKTNIGKTKSFASHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q20EU8-F1 | 508-649 | 97.90 | 65.32 | View in AlphaFoldDB ↗ |