DPCfam | MC411570
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Residues in low-complexity regions (%) | 1.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.23 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01613 |
| Sequences matching dominant architecture (%) | 92.54 |
| Average overlap percent | 17.96 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8QEU5 | 12-129 | 118 | EAAIQRNPHADFGAVERARPPFDHRSQMTFTKTPNPDWKAGSGASNEEWKEHEYVTIDPYEEGRGPWLNYKLLVSATVPRPIALA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PHY8-F1 | 71-179 | 100.00 | 95.42 | View in AlphaFoldDB ↗ |