DPCfam | MC411273
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 742 ± 142 aa |
| Residues in low-complexity regions (%) | 3.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.23 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF05131 |
| Sequences matching dominant architecture (%) | 40.88 |
| Average overlap percent | 17.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061H328 | 212-1186 | 975 | KMFADPSGTHLILTMRNGDCYYWATGWRKARLLNKLKGVLIESVAWNKSTLDPVAPAAASGQGARKRGGAASGALASTREILVGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P59015-F1 | 160-950 | 100.00 | 77.70 | View in AlphaFoldDB ↗ |