DPCfam | MC4111
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 132 ± 12 aa |
| Residues in low-complexity regions (%) | 3.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02536 |
| Sequences matching dominant architecture (%) | 28.0 |
| Average overlap percent | 19.39 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M0RPE6 | 27-160 | 134 | KNLRYYYRARALAEAQRFLTDYLHCTRSLPFSHAESIAYNSPFTLSDLVSQFRFPPDAVAADVKVALHRFLSYRPINEFEFFFES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1M7J9-F1 | 48-173 | 97.78 | 91.55 | View in AlphaFoldDB ↗ |