DPCfam | MC411095
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Residues in low-complexity regions (%) | 2.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B1P8K0 | 11-110 | 100 | VDFLILGAGWTAGYLIPLLKSMEISYAATTTTGRDGTYKFKFEYDPNTNNQASNIDLKPYAQLPYAKTILITFPIAGELSSLWLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CEE6-F1 | 18-131 | 100.00 | 90.24 | View in AlphaFoldDB ↗ |